GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4,55

Based on 794 opinions finded in 2 websites

4.5Ambience4.5Cuisine5.0Price5.0Service
site_photo4

Nº 3 in 37 in Mint Hill

Nº 1 of 2 Asian in Mint Hill

CUSTOMERS TALK ABOUT DISHES WITH..currychickenmintricefriedeggshrimpsesamespicysoupbroccoli

comment_iconOpinions

Everytime I come home to visit my parents I have to eat here!!! Yum!!

site_logo

Battle Braces . 2024-08-04

MORE AT Google

Their food is excellent and their customer service is the best!! ❤️❤️Love this place!

site_logo

E H . 2024-07-20

MORE AT Google

I don't often leave reviews, but these good people earned it. The food, service, price, and timeliness was wonderful as always. What we didn't expect was to see our waiter rushing outside to return a pair of forgotten sunglasses to some customers that had already left. After that, we watched the staff collectively help a customer get back into a car she was locked out of. Good food, great people. 10/10

site_logo

Brandon sever . 2024-07-20

MORE AT Google

Service wasn't as great. They mixed orders

site_logo

Biz Boum . 2024-07-18

MORE AT Google

Took a friend to lunch today. I ordered the chicken and pineapple lunch special and was immediately sick after. I will never return.

site_logo

Shanae F . 2024-07-11

MORE AT Google

Soooo not happy. Normally, I enjoy the food but tonight must have been an off night. I ordered Pad Thai and Hawaiian Fried Rice. The barely fried rice was completely bland, no flavor at all, with the chicken boiled white in color. The Pad Thai was horrible. Pink in color with crunchy noodles...that is not Pad Thai. More like hard noodles thrown in sweet & sour sauce. Not only did I spend $48, I left a $6 tip just to come home and fix their food. Highly disappointed, will not be back.

site_logo

EM G . 2024-06-29

MORE AT Google

One of our favorites. Always great food and service is best around!!

site_logo

Connie Carlucci . 2024-06-17

MORE AT Google

Good food, portions, and friendly staff. Prices aren't too bad either.

site_logo

Chandler Johnson . 2024-06-04

MORE AT Google

Food was still cold like. Out the refrigerator very mean staff

site_logo

Savannah . 2024-06-03

MORE AT Google

Went there to enjoy a lunch with my mother, and was extremely happy with the choice. This is an upscale Chinese restaurant, the employee treated us with the utmost respect, the food was great and on our table within minutes of ordering. Lots of food for a great price, loved the atmosphere there.

site_logo

Spencer Hunt . 2024-05-26

MORE AT Google

Good food priced Right be back soon. Always a good meal here. Still very consistent quality. After several years now.

site_logo

John Frame . 2024-05-24

MORE AT Google

Food is ALWAYS AMAZING! Service is impeccable... atmosphere is nice & quiet... decor average but that doesn't even matter! This food is OUTSTANDING!

site_logo

JudyLynn Palmer . 2024-05-20

MORE AT Google

Sadly disappointed. Ordered general tso chicken - it was over fried and the sauce was mid (it was also very ginger forward). Not my favorite Chinese spot, and at $16 it’s expensive.

site_logo

My Account . 2024-05-13

MORE AT Google

Food is always great as is the service. I usually do not get beef as Asian restaurants because it's tough, but here, I always get it. Their beef is so tender. Tried about 6 Asian restaurants, and this is the best.

site_logo

Carmela Giambalvo . 2024-05-04

MORE AT Google

I have been eating at this restaurant for 20 years. The food and service are on point all the time.

site_logo

larry white . 2024-04-27

MORE AT Google

Staff was friendly and service was fast. Food was delicious!

site_logo

Angela Kilgo . 2024-04-25

MORE AT Google

Food and service is always good. This is our go-to for Chinese takeout. EDIT: I think something has changed here with either management, kitchen, or both. Service is still great, but the food has not been up to par with what it use to be. Teriyaki beef sticks were bland, dumplings not the same quality they were. I think we're going to start looking for alternatives.

site_logo

Shannon Smith . 2024-04-21

MORE AT Google

Great spot for Chinese sit down meal! Very nice staff and quick service.

site_logo

stephanie Williams . 2024-04-17

MORE AT Google

Always good food & service from this restaurant!

site_logo

Dwayne Dunham Sr . 2024-04-17

MORE AT Google

We've been going there for years. The past few months, they've been awful. Tonight we ordered carry out, shrimp and broccoli, sesame chicken and a egg roll. One white rice, one fried. We got two fried rice, cashew shrimp, sesame chicken and no egg roll. I had to throw the sesame chicken away because it was so bad. Tasted like the sauce was made with catsup. My wife ate the shrimp, but it wasn't so good either. For the money, we'll find someplace else.

site_logo

John T. . 2024-04-13

MORE AT Google

Absolutely disgusting! Food was cold & terrible; don't know how this place has such good reviews.,.

site_logo

CP Godfrey . 2024-04-05

MORE AT Google

Love the hot, fresh food. Take out normally, but to sit in the restaurant is different and it was just as amazing !

site_logo

Chandra Williams . 2024-03-30

MORE AT Google

We order from here almost every weekend and it never disappoints :) one of my favorite spot in Mint Hill

site_logo

Shabika V . 2024-03-23

MORE AT Google

The food and atmosphere are excellent. Staff are friendly and accommodating. The restaurant is spotless.

site_logo

Ty Barrett . 2024-03-18

MORE AT Google

Excellent food and service 5 stars! I have been coming here since they opened. Sesame chicken - House fried rice with no pork.

site_logo

chris shaw . 2024-03-17

MORE AT Google

Great service and food! Finally found a Chinese restaurant that doesn't make everything overly sweet!!!

site_logo

Sanjay Patel . 2024-03-16

MORE AT Google

The BEST Chinese restaurant! They have amazing food and the nicest staff who remembers our names and even our usual food and drink orders! Wonderful!

site_logo

Tricia Schmidt . 2023-12-31

MORE AT Google

The food was delicious. I totally forgot to snap a picture. I'd for sure come again! I had sesame chicken, fried rice, and a spring roll!

site_logo

Almond S. . 2023-12-22

MORE AT Google

Stopped by for dinner, and it was delicious. Good food (fried rice was my fav) good service good prices no complaints.

site_logo

Pam Martinez . 2023-12-15

MORE AT Google

This was our first time eating here. The service was amazing and the waitress kept checking on us and was super friendly. The food was all made fresh as it was piping hot and really good. I am not sure why we waited so long to eat here, but we’ll be back.

site_logo

Robin Frisby . 2023-12-10

MORE AT Google

Best chicken fried rice I have ever had!!!! The food here is amazing!!!

site_logo

Charles Debruhl . 2023-11-23

MORE AT Google

Little Pricey for what you get.

site_logo

Roger Moore . 2023-11-16

MORE AT Google

Delicious mix of fresh and healthy vegetables, perfectly cooked for the vegetarian options we ordered; clean flavor for our vegan lifestyle. Sesame tofu as a side was delicious! We’re excited to find this restaurant

site_logo

D W . 2023-11-12

MORE AT Google

Came here for much needed time with my best friend. Yall, I'm vegan too, this place had a ton of great options. Please don't hesitate! The food is incredible, AND affordable as far as eating out goes!!

site_logo

Danielle Day . 2023-11-04

MORE AT Google

I pass by many similar resturants on the way to New Asian.Enough said.

site_logo

Jenny Briggs . 2023-11-02

MORE AT Google

Lady that answers phone is extremely nice. But we have just moved here & given this place a try twice. Everything was pretty bad; sesame chicken, soggy & sour. Veggie rice bland, terrible egg rolls & the Teriyaki beef sticks had a strange taste & were tough. Never again!

site_logo

Ryan Godfrey . 2023-10-24

MORE AT Google

I couldn't round up to 4 stars because they're about a 3.5. The service is great. Very friendly and welcoming staff. The food is a little underwhelming. For example the Hibachi sauce is like vegetable water. It needs to be thickend with a paste. I've had better garlic/ginger sauce everywhere else. The curry noodles are lacking in flavor and spice. Their fried rice dishes are good. I like this restaurant and want to continue coming but the food needs a little love.

site_logo

Lumana Rai . 2023-10-02

MORE AT Google

Been coming here for years. Always great.

site_logo

Derrick Efird . 2023-09-24

MORE AT Google

Visited this place a few days ago. I am new to Mint Hill. Let me just start off by saying the food is the absolute best Asian food I have had since moving to NC! The food was fresh and hot when served. The service was quick and efficient. Although the waiters seems to move very quickly, they were still professional and friendly. I needed a bit more time to review the menu. Maybe not rush new customers to order, it could have easily been a 5 star review.

site_logo

Mariah Davis . 2023-05-07

MORE AT Google

Good rating 97.5 Exterior clean and maintained Easy parking Greeted upon entry Escorted to table Easy to understand menu Ordered chicken fried rice with egg roll Excellent wait staff Food arrived within 3 minutes Hot food Large serving for lunch Cooked perfectly Probably the best I have had Drinks refills without asking Attentive waiter Money taken at table Friendly staff Good price $18 for my wife and me Looking forward to returning very soon Best place to dine in Mint Hill Enjoyed entire experience

site_logo

Sonnie McRae . 2023-04-28

MORE AT Google

This place is amazing. Was introduced to it last week by the family, and went back today. The food is fresh and flavorful. Prices are reasonable and the staff is very friendly and helpful. My new #1 asian place to go. Only bad part is that they are in Mint Hill and I am in Concord.

site_logo

andrew hamilton . 2023-04-22

MORE AT Google

Have been here a number of times. Always consistent. The gracious Asian social graces are evident. The house special fried rice cannot be topped. Also love the BBQ ribs. To go orders always ready and packaged to get home still moist and warm.

site_logo

ken caudle . 2023-04-07

MORE AT Google

Great restaurant! It’s our favorite Chinese place in the area. Great staff, fast service and delicious and fresh food!

site_logo

Anna Lamborn . 2023-04-07

MORE AT Google

Everything we get here is phenomenal! My favorite is the Mei Fun, it is the best I’ve found since moving here! We’ve tried several things in the menu and everything was very good!! This is my go to place now!!

site_logo

Shay Smith . 2023-04-07

MORE AT Google

I went to this restaurant for first time and never regret, the service is excellent, food is delicious and decent prices; I'll be happy to come back again 😋

site_logo

ASTRID L. SERRANO LOPEZ . 2023-04-04

MORE AT Google

The food is always really good here. My only qualms about the place is that you have to order at the front and sit down and wait on your food. This changed during covid and I really wish they'd get back to the standard model again. Also the waiting staff is not as good as I'd like it to be. They seem usually like they are new inexperienced and not really wanting to be there.

site_logo

chad moss . 2023-04-02

MORE AT Google

It's been difficult to find a good Chinese restaurant in NC.

site_logo

MAD TITAN . 2023-04-02

MORE AT Google

After read all reviews I decided to try this restaurant and I don't regret at all, best decision; they have excellent service, the food was so good and good prices, I'll will come back 😀

site_logo

Astrid serrano . 2023-04-02

MORE AT Google

I ordered something the server had suggested for my gluten-feee needs. It was excellent! I was very happy with the food. My server was helpful.

site_logo

Valerie Sorensen . 2023-04-01

MORE AT Google

My husband and I are new to Mint Hill and we decided to try New Asian this past Friday. I had the Thai Shrimp curry and my Husband had the Sa Cha Shrimp..both were amazing! We will definitely become regulars!

site_logo

Mary Lynn Shorac . 2023-03-26

MORE AT Google

Food was great. Very busy but staff was very helpful.

site_logo

Wayne Biggs . 2023-03-25

MORE AT Google

probably the cleanest and best tasting chinese food within a 50 mile radius. the lunch specials are our go to. we add shrimp spring rolls &hot and sour soup to our order every time. So good

site_logo

l l . 2023-03-19

MORE AT Google

Ww have been coming here for years and there's nothing like it. Its the best Chinese place ever!!

site_logo

Becky Price . 2023-03-18

MORE AT Google

I got chicken and cashews nuts, it was GOOD. What I didn't eat I was happy to take home and eat later that day.

site_logo

Hawkeye in the house . 2023-02-27

MORE AT Google

Good service. The booths aren't very comfortable. Everything we've ordered has been good. Pork Lo Mein is my "go-to".

site_logo

Josh Rogers . 2023-02-07

MORE AT Google

Always good. Staff is pleasant and efficient.

site_logo

Susan Moll . 2023-02-01

MORE AT Google

My favorite Asian cuisine place. We have been coming here for years. Great service and people that own it. All staff are so friendly. Give it a try.

site_logo

Shawn Glanzer . 2023-01-28

MORE AT Google

Always very friendly and the food is served hot and good

site_logo

Lenna Crockett . 2023-01-14

MORE AT Google

Some of the best Asian food I've had in a long time.

site_logo

John Hudnall . 2023-01-13

MORE AT Google

My go to asian restaurant! The best quality and you can’t beat the price. The hot and sour soup is the best I’ve ever had. Consistently great and awesome service!

site_logo

Chandler noyes . 2023-01-12

MORE AT Google

Food is okay. I ordered hibachi to go. All the food was mixed together. If you are used to your protein being seperate from the vegetables, dont order hibachi. I've had the chinese too, it was okay. We called at 11:30am and ordered food. Got there to be charged dinner price. Didnt think I would need to say lunch. Better yet, whoever takes the order should ask if I want dinner for lunch!

site_logo

N B . 2023-01-06

MORE AT Google

me and my wife learned that Asian food and Chinese food are prepared differently but similar after eating here. We prefer Chinese food but we can say that we tried asian.

site_logo

Lamont Channel . 2023-01-05

MORE AT Google

I would give them 10 stars if I could! The absolute Best Asian food in Charlotte. Well, the best I've ever had, anywhere! The food is always cooked to perfection and the service is impeccable. By far one of my favorite places to dine!

site_logo

lesrobcharlie . 2023-01-02

MORE AT Google

Some of the best food I’ve had there in a long time! Everything was so fresh and delicious.

site_logo

Brian Lipszyc . 2022-12-23

MORE AT Google

New Asian Cuisine has been our corner favorite for years! Service is always friendly & quick! Excellent vegetarian options.

site_logo

Slowfoot . 2022-12-22

MORE AT Google

Overall ok, but disappointed that it was not real fried rice that has scallion & eggs, etc in the rice.

site_logo

Paulette Lang . 2022-12-21

MORE AT Google

Always good experience only place I will go in area for general tso

site_logo

Jason Thompson . 2022-12-12

MORE AT Google

We were looking for a new Chinese restaurant as the many others we had tried just weren’t hitting on much. Several neighbors told us to give New Asian a try and man am I glad we did. Their food is absolutely delicious and consistently good as we’ve gone several times since our first trip over the last month. My personal favorite is the sesame chicken and fried rice and my husband loves the beef and broccoli. Overall the food has exceeded our expectations and we will be back.

site_logo

Kelli Holt . 2022-12-07

MORE AT Google

Great Asian food! Very nice people own and operate this restaurant. Always good service and quality. Have missed them very much being closed since mid March due to Covid, however saw a sign on the door that they will reopen for take out only on June 3rd 2020. We are so happy! See updates below: Update: They are now open for dine in as of June 2021...which is wonderful! Continued great food and friendly service! UPDATE Nov 2022. This restaurant never ceases to satisfy! A great chef, friendly and efficient staff, and most importantly, GREAT food. Keep up the good work and don't change!

site_logo

Linda Blackburn . 2022-11-30

MORE AT Google

Place would not let a disabled person with a service animal eat there. Reported to civil justice division of the justice department.

site_logo

andrew schmeuszer . 2022-11-26

MORE AT Google

Ah So! 👍 “Ah, so” is an informal way to say “Is that right?” or (“Hai” is “Yes”, and “Naruhodo” “I see”)

site_logo

Abercrombie Realty . 2022-11-23

MORE AT Google

We love it here! No complaints

site_logo

Jasmine Sumter . 2022-11-22

MORE AT Google

Amazing, as always! Friendly service, great food.

site_logo

Chris Kotze . 2022-11-14

MORE AT Google

Very clean store and food is delicious 😋

site_logo

safwat wassef . 2022-11-12

MORE AT Google

Very good food and service. Loved the egg drop soup.

site_logo

bill thrailkill . 2022-11-11

MORE AT Google

Sanitation grade 90.5 looked up violations, need to improve before I return. friendly staff but need supervision in kitchen.

site_logo

Mike Chaffin . 2022-11-11

MORE AT Google

I've been looking for a Chinese restaurant in the area. This one was very good. They were quick, and the meal was very good. I had leftovers. Mongolian Beef is delicious. Not that fond of the General Chicken, but the Garlic Shrimp & Chicken is also delish. They use real shrimp, not that baby shrimp!! Gentleman at the counter was very personable. The restaurant was clean, simple. I will need to try more dishes to give a further review.

site_logo

Tina Gale . 2022-11-08

MORE AT Google

I usually get their spring rolls and lo mein and it's always delicious. The staff are always very friendly as well.

site_logo

Haruko B . 2022-10-23

MORE AT Google

I get the scallion chicken, every single time it is so good. The quality is high and the flavor is incredible.

site_logo

Will Faircloth . 2022-10-21

MORE AT Google

Their food is in a league of its own!!

site_logo

sharon cordell . 2022-10-19

MORE AT Google

One of the Best Restaurants in Mint Hill/Matthews

site_logo

Rodney Colson . 2022-10-17

MORE AT Google

Great shrimp and brocolli ;but egg roll was overfried and greasy and tiny. Avoid chicken wings they were pink inside..not safe to eat and a waste of 7.25. Very nice staff though.Not sure if I would return. Its been a challenge to find a good chinese food spot here in Charlotte.

site_logo

Joe D . 2022-10-17

MORE AT Google

Been going here for at least 2 years weekly. Love it. Never had a bad meal. The food is fantastic and the staff is great. They are great remembering you. They already know what my husband and I want when walking in door.

site_logo

tricia moore . 2022-10-16

MORE AT Google

Best frye rice in town and great costumer service

site_logo

Yxayana Pena . 2022-10-14

MORE AT Google

Excellent Singapore noodles,,I order with chicken & shrimp mild, and veggies.

site_logo

Bee Lite . 2022-10-02

MORE AT Google

It was great to actually have an Asian resturant that you can sit and order and have real plates etc., Food was good just wish they had traditional tea pot/ cups.. I missed that

site_logo

Ima Momfirst . 2022-09-30

MORE AT Google

Love this restaurant! Great food, reasonable prices and great service.

site_logo

karen kennady . 2022-09-23

MORE AT Google

They make the best chicken almond that I ever had. The owner and his staff are always so friendly. I called in my order while driving on the interstate. As soon as I said my name the owner said: Awe Miss Church will you be getting your usual with a sweet tea. I just giggled. I would recommend this restaurant for either dine in or carry out.

site_logo

Jeannerae Church . 2022-09-16

MORE AT Google

Never a bad meal here. Honey chicken, Thai basil Chicken, Curry sauce. So many delicious options. Plentiful. Mid range cost but you will have leftovers for tomorrow. I think they are closed on Tuesdays.

site_logo

J Wyatt . 2022-09-07

MORE AT Google

Ate food last week with Mi Ma. The food was music to my lips. She orders a sixer of Wonton Soup. Simply delicious!!!

site_logo

Derek Romano . 2022-09-04

MORE AT Google

The employee's there are very very polite.

site_logo

Don Myers . 2022-09-02

MORE AT Google

Food was excellent and the service was great

site_logo

Alan M Husband . 2022-08-28

MORE AT Google

OmG!!!!!! If you haven’t tried this place….I am still amazed at the taste and texture, crunch….I have never had Sesame chicken that was this good. Ok, so if you are ever in that area this place is a must. The outside of the business is quite the opposite of what their chef prepares. Yes, I said chef. This isn’t like any you’ve had before. If it is please leave a comment, bc I really would like to know. My son and I stopped in and had an early dinner date. At first bite his eyes grew enormous and he said, Mom!!!! This is the best Chinese food ever!!!!!!! Neither one of us could stop talking about it. It was the way the chicken was lightly and perfectly fried. He and I shared a plate. They served the chicken with a large scoop of fried rice. We also ordered a side of Lomein and an egg roll. The egg roll was fresh and tasty. We both ate and we’re so full and still brought home a small Togo box! Out the door…$26.00 tip included.

site_logo

castAspell . 2022-08-27

MORE AT Google

Their food is usually great. I'm dealing with some parosmia from covid very recently(most food tastes rotten) and their chicken lo mein is one of the few things that tastes normal to me. The staff is friendly, definitely support them!

site_logo

Jesse Standard . 2022-08-10

MORE AT Google

Good food and decent portions for the price. The staff were great.

site_logo

Kenneth S. . 2022-08-10

MORE AT Google

Always great food and service. Wonderful staff

site_logo

Wayne Biggs . 2022-07-28

MORE AT Google

Excellent portion size. Very tasty food.

site_logo

Partha Saha . 2022-07-25

MORE AT Google

Staff is friendly and food is always good.

site_logo

Troy Sacco . 2022-07-21

MORE AT Google

The food is always great, however my fiancé called this time around and ordered Sesame chicken & the fried rice.. since she didn’t say that she wanted the “lunch special” even though it was 1:30pm.. when I picked it up they’d charged her for the dinner sesame chicken.. really why would we want to pay more for dinner when it was lunchtime. I went ahead and payed.. then my fiancé called and questioned it. She was told “ you didn’t say you wanted the lunch special”… almost double the price was incredibly unnecessary.

site_logo

Jj Free . 2022-07-21

MORE AT Google

Some of the best food around, absolutely love this place

site_logo

Evan Dildy . 2022-07-19

MORE AT Google