GastroRanking-logo

Thai Taste in Dover - Phone Number, Reservations, Reviews

whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4,40

Based on 336 opinions finded in 2 websites

4.4Ambience4.4Cuisine4.4Price4.4Service
site_photo4

Nº 18 in 51 in Dover

Nº 1 of 2 Asian in Dover

CUSTOMERS TALK ABOUT DISHES WITH..ducksoupcurryricefriedchickenfishspicymangopineapplecrabnoodles

comment_iconOpinions

Close walk to downtown, good portion sizes for a great price.

site_logo

Conor LaSelva . 2024-07-09

MORE AT Google

A+ for their delicious sauces and crispy, flavorful (but not greasy) crab rangoon and potstickers. Very friendly and fast service, too. Sadly, my favorite dish, Thai Fresh Rolls, were subpar. Just lettuce, carrot, and a slice of cucumber loosely wrapped in the rice paper skin. No basil or mint, and no protein option, so they were very bland.

site_logo

Suzanne Morrissey . 2024-06-24

MORE AT Google

Food was ok, not great. Was a little pricey. They were not very friendly. I would give it a second try.

site_logo

Ryan A . 2024-06-16

MORE AT Google

Pad Thai its so good.. 😁👍 , i will come back again..

site_logo

Fendy Andreas . 2024-05-03

MORE AT Google

I have ordered a GRILL FISH (SPECIAL), CRAB FRIED RICE, BEEF PAD SE YU, and of course, THAI ICE COFFEE. All of them are deliciousssssss. Thank you Thai Taste.

site_logo

Albert Sutanto . 2024-04-29

MORE AT Google

Ordered for the 1st time, and they did not disappoint! Had it door dashed to my work, and it was still piping hot! I'm so glad they offer this! Panang Curry was soooooo amazing. The perfect amount of heat with so much fresh flavor!. Chicken pad Thai is an obvious anytime and always my go-too for lunch leftovers. We also tried the mango sticky rice for dessert. Never had it before. The mango was so fresh and amazing. Wasn't sure if I was supposed to eat it warm or cold, but it was really light and good. Wasn't my favorite because the rice was kind of hard to eat other than that. Everything was so tasty and we will definetly be back to eat inside next time!

site_logo

Megan Lewis . 2024-04-16

MORE AT Google

Food and Tai Iced tea was delish. Service was fast. I also got the fried ice cream which was 10/10

site_logo

Shannon Breault . 2024-04-01

MORE AT Google

Unfortunately the heat was on the fritz when I stopped by, but I was picking up take out so it wasn't a problem. The food was very good! I'm vegan so I rarely eat out because a lot of restaurants don't have a good vegan selection but this place had more choices than any other place I've been to. Awesome food.

site_logo

Bess-Lyn Sannino . 2024-02-22

MORE AT Google

Loved the food. Nice and quiet. Food was fast to come out. Waitress was really kind.

site_logo

Aden Martineau . 2024-01-20

MORE AT Google

Insanely good food! Not what you would expect from the area! Daughter and I could not get enough of the duck curry!!!

site_logo

Jennifer Luna . 2024-01-07

MORE AT Google

Food is OK, owner is extremely rude.

site_logo

I. Engin Taze . 2023-12-01

MORE AT Google

Love this place-- good food and wonderful staff.

site_logo

David F . 2023-09-17

MORE AT Google

They do not speak English very well

site_logo

Tim Stockwell . 2023-08-08

MORE AT Google

Nice clean place, food was tasteful, service was very good.

site_logo

Scott Lagro . 2023-08-04

MORE AT Google

I just has to spit out rancid chicken into my napkin. Totally unacceptable and disgusting. I will report if I end up with food poisoning. My family hated their food. A Taste of Thai at 2190 White Mnt Highway, NorthConway is dirty and the service was terrible- the server didn't greet us when we entered other than demanding "How many?" She also didn't bother removing any used dishes from our table.. Bottles of hand sanitizer everywhere and an out of order bathroom sign.. Just so gross in everyway- 7/31/2023.

site_logo

Adele Marky . 2023-08-01

MORE AT Google

Solid food. Asking for your dish to be hot will result in a pile of red pepper oil with indigestable seeds being added to your dish. Otherwise very solid.

site_logo

Matt Bates . 2023-07-18

MORE AT Google

I absolutely love this restaurant! Quiet atmosphere & wonderful service. The "House Pad Thai" is out of this world. 🍲🍴

site_logo

Elise C . 2023-07-08

MORE AT TripAdvisor

Host/Owner is very rude and loud!

site_logo

Deneise Williams . 2023-07-08

MORE AT Google

Excellent Pho and Papaya salad!!! We’ve been looking for a great place to eat pho and this is it!

site_logo

M B . 2023-06-11

MORE AT Google

This is probably my favorite Thai restaurant regardless of being a chain restaurant. The food is amazing the service is fast and friendly. I would recommend it to anyone!

site_logo

Andrea Leslie . 2023-05-14

MORE AT Google

Food was really good. Atmosphere was okay. Most orders were for takeout.

site_logo

Nabil Al Nahin Ch . 2023-05-01

MORE AT Google

Great Taste, a bit pricey but peaceful and authentic!

site_logo

M S Khan . 2023-04-27

MORE AT Google

Awesome food , friendly staff and fast service .

site_logo

Village Motors . 2023-04-24

MORE AT Google

Quiet, relaxed food place. The beer pho was nice but the chili paste fried rice was the real bomb (seasoning is just chef’s kiss).

site_logo

끅 . 2023-04-23

MORE AT Google

The Beef Pho is mmmmm Goood!!!!!!

site_logo

Alex Downing . 2023-02-19

MORE AT Google

Food is delicious! Will be eating here a bunch 😁

site_logo

Reid Swanson . 2023-02-03

MORE AT Google

This restaurant makes everything fresh to order. No precooked meals. Very fresh tasty food. Vegetables in curry dish were bright colors and cooked al dente. Yummy food!

site_logo

Nanci Knight . 2023-01-16

MORE AT Google

Thai Taste offers some of the best Thai cuisine around. Have never been disappointed with dish they offer. Portions are plentiful and food is extremely fresh. Our go to place for Thai cuisine.

site_logo

Brian Lothridge . 2022-12-26

MORE AT Google

This is a nice quiet spot for dining if you're looking for a party of two and quiet atmosphere. Food was average, and the presentation I would say was a bit less than average, but it was tasty nonetheless you had good flavor

site_logo

Khadijah Cisse . 2022-12-01

MORE AT Google

Amazing food. Great service. Excellent portions.

site_logo

Ryan Crosby . 2022-12-01

MORE AT Google

The woman is very sweet. Quiet and low key place to eat. Hidden gem! I accidentally devoured half of the meal before deciding to take the pictures. This is the basil duck. It's a little spicy as shown on the menu but delicious. Great cuts.

site_logo

Kayla Jury . 2022-11-13

MORE AT Google

I’ve ordered takeout here many times and it never fails to disappoint. We were there in person during Dover Apple Day and decided to stop in. Even better in person and the owner is so friendly.

site_logo

Eric Goldfisher . 2022-10-03

MORE AT Google

Pretty decent pad thai and drunken noodle. Needed an acid of some kind, but it is worth a visit.

site_logo

Dylan . 2022-09-25

MORE AT Google

This is mt first time having thai taste and the yellow curry is amazing. The spices are complex and the chicken and vegetables taste really fresh. Not to mention, the staff is so kind and attentive! If you're looking for delicious thai food in dover, go to thai taste.

site_logo

Sarah Carbonara . 2022-09-14

MORE AT Google

I legit go weekly. Best Thai food in the area hands down! I’m never disappointed with the food, it is very delicious. My personal favorite things are the duck curry and basil duck! Definitely stop by for some comforting Thai food!

site_logo

KIRY . 2022-09-12

MORE AT Google

Great plant based, vegan options! Quick turnaround...

site_logo

J Angell . 2022-08-29

MORE AT Google

The taste is awesome. But the food is rather expensive. Don't forget to try the Spicy noodle(no.60) that's my all-time favorite!

site_logo

ian Yoe (_ian_) . 2022-08-21

MORE AT Google

I will never go to this restaurant again!The food is not good.

site_logo

胡倩 . 2022-08-09

MORE AT Google

Very nice service food very excellent highly recommended it very clean food is amazing yummy 😋

site_logo

james boisvert . 2022-08-05

MORE AT Google

Soup was great. Lo- mein was ok. Not much for drink options.

site_logo

Coty Phachansiri . 2022-07-21

MORE AT Google

Food was tremendous and service was to match... great place all around

site_logo

Dan Dixon . 2022-07-11

MORE AT Google

Fantastic lunch—Food, service, and atmosphere were perfect! Prices were also very reasonable with the lunch menu. I loved the shrimp pad Thai and others enjoyed the green curry and soups.

site_logo

Allison MacLeod Krenn . 2022-07-02

MORE AT Google

Authentic taste! Prefered place for thai in dover! CUSTOMER SERVICE WAS RUDE. Someone should teach the guy about kindness and respect.

site_logo

Ron . 2022-05-01

MORE AT Google

Food is great. We placed an order 4/18 and picked up in store. Woke up this morning to find my credit card had been used at Yamibuy and Apple MFI at 1238am last night.

site_logo

Andrew RVA . 2022-04-19

MORE AT Google

Fried dumplings were really top notch. I also had the Thai fried rice and was disappointed that there were large tomato chunks in it. I've never had that in Thai fried rice before, so I was confused. It didn't add much to the otherwise good dish. Service was fast and friendly. Parking is a little tough

site_logo

Jason Hall . 2022-04-14

MORE AT Google

I stop in here every week for a bowl of pho and I love it.

site_logo

Ben Gitty . 2022-03-18

MORE AT Google

Awesome Thai food from an incredibly friendly staff, will be back again!!

site_logo

Kelsey Kidd . 2022-03-06

MORE AT Google

Love the food here! They do a wonderful job delivering yummy food with a smile.

site_logo

Marci Stone . 2022-02-27

MORE AT Google

Always fantastic!! Best crab rangoons ANYWHERE.

site_logo

Kate Dusinlleux . 2022-02-14

MORE AT Google

Very nice quiet restaurant with great food. The Thai iced tea was delicious

site_logo

Nicole Rieder . 2022-01-28

MORE AT Google

Thai Taste has a great menu and always has delicious flavorful food! I was so excited to see they serve pho and I’ve gotten it many times since discovering it!

site_logo

Liam Lundt . 2022-01-10

MORE AT Google

Remarkable find tucked away in a little shop on Main Street...have driven past it for years not seeing Thai Taste. Really sorry about that! Authentic, delicious, food and excellent customer service. We'll be returning a lot!

site_logo

Mark DuMars . 2021-11-17

MORE AT Google

Great home made pho (I had the beef pho & the duck pho).

site_logo

Ian McCloy . 2021-11-16

MORE AT Google

A good Thai spot in town, and the only one open on a Sunday right now of the three close-by (Sara Thai and Kaphoums). After eating here we all agreed it was good, not great, and that we prefer the two aforementioned restaurants when we are eating Thai. That's not to say everything we had wasn't good; it was, just that I think there are better close-by options.

site_logo

James Smith . 2021-11-12

MORE AT Google

Rad Nah was delicious! Definitely a more intimate dining experience with the smaller dining room, but very cozy, and excellent food!

site_logo

David Dichard . 2021-10-18

MORE AT Google

Fresh tasty food cooked in traditional Thai style. Additionally broad variety of vegi deli keto and carnivore

site_logo

Richard Jussel . 2021-10-08

MORE AT Google

First time here. Nice atmosphere and staff. Food was great. Looking forward to going back!

site_logo

Peggy Wishart . 2021-08-04

MORE AT Google

Wonderful curry and beef salad. Fresh rolls and spring roll good too. Good service.

site_logo

Nancy Carnes . 2021-07-25

MORE AT Google

Whole fish is recommended for those who eat fish is not a fillet. No other place have that on the menu.

site_logo

Mohammad Reza . 2021-07-06

MORE AT Google

Best drunken noodles I've had so far since moving here. Found my go-to place when I'm craving Thai food :) Also tried the pad Thai and it was pretty good!

site_logo

Sami C . 2021-07-01

MORE AT Google

Great ambiance, fabulous food and wonderful service, a real gem

site_logo

Pat Bartholomew . 2021-05-24

MORE AT Google

Amazing Thai food, and always consistent - with flavor, portions, and quality. The staff is super friendly. Highly recommend!

site_logo

Brittany Gilmore . 2021-02-20

MORE AT Google

Got the house pad thai (lots of chicken, tofu, and shrimp), chicken pad thai, and the drunken noodles. All are a hit and delicious, we definitely will be coming back for more!

site_logo

Karl Sofa . 2021-01-16

MORE AT Google

We frequent Thai Taste a lot!!! The only thing we have trouble with is we always order pad thai, with a 1 star. Sometimes it tastes like a 3 star, sometimes a no star. It's very inconsistent. We never know what we are gonna get.

site_logo

Bobbijo R . 2021-01-03

MORE AT TripAdvisor

Wow, I’m glad we tried this again! We were a little disappointed when it first took over from Thai Cuisine but it’s really gotten very good. We were super impressed. Every single thing was delicious!

site_logo

Lydia Beller-McKenna . 2020-10-24

MORE AT Google

Great tasting, typical thai food. Good portions and reasonable prices, we are never disappointed with our choices here. No in store seating is available right now, but they are open for takeout.

site_logo

Lenny Adams . 2020-10-22

MORE AT Google

I got veggie Pad Thai and veggie Tom Yum. The food was really delicious, but I only gave four stars because I didn't get any tofu, which is clearly on the menu. I'll be back though!

site_logo

Joanne Sawyer . 2020-10-19

MORE AT Google

This the second time I’ve been here, the food is hot and really tasty! Staff is friendly and welcoming as well.

site_logo

Michela Lamparelli . 2020-09-04

MORE AT Google

Delicious! Easy to order on line and pick up

site_logo

Mim Smith . 2020-07-26

MORE AT Google

We ordered from Thai Taste last night for the first time. It was really good. We ordered take out and even after the 20 ride home everything was hot. Pad thai with chicken was fabulous, as were the spicy drunken noodles (choosing the spice level is awesome). The website for ordering is very easy and well done. I think we found our new favorite Thai place!

site_logo

Jennifer Hall . 2020-06-14

MORE AT Google

Fresh, amazing food. Great customer service. Extremely clean atmosphere. Will always go for the shrimp pad Thai. The owner is wonderful and friendly. Overall...5 stars

site_logo

Kendra Murphy . 2020-06-05

MORE AT Google

Best thai food around the area. Taste authentic, and the spiciness oh my god, asian level of spicy. Tom yum soup extra spicy really delivered the expectation. Our fave combination is always salmon curry and pad see ew.

site_logo

Octavianus Asoka . 2020-04-27

MORE AT Google

Their food is always excellent. Best Thai-Asian spot on the Seacoast. Curry, Pho, Crab Rangoons, #1! The restaurant and kitchen are also the cleanest I've seen yet. Favorite spot!

site_logo

Amelia Trapp . 2020-03-21

MORE AT Google

Got a duck curry for lunch, was outstanding!

site_logo

Matthew Feldman . 2020-03-15

MORE AT Google

Great food. Good staff. Lovely little hole in the wall.

site_logo

Lauren French . 2020-03-06

MORE AT Google

This location was the home to several Thai themed restaurants and now is called Thai Taste. Stopped in to pick up some takeout. The host was in a parka and wearing a wool hat (a little chilly inside?). The lone server was sitting at one of the tables engrossed in her smart phone. There was nobody else in the restaurant on a Saturday night. The cuisine lived down to the expectation set. If you have a craving for really mediocre Thai food, hurry on in.

site_logo

zman-nh . 2020-02-28

MORE AT TripAdvisor

This place has never let me down 2nd review for the year, don’t listen to the scummy posts from the Rochester locals. They can’t compare thai food, they don’t know what good food is in comparison to frozen burgers from the Somersworth Walmart

site_logo

Shiloh King . 2020-01-04

MORE AT Google

Staff is so warm and caring! Food was flawless!!

site_logo

Daryl Mc Gann . 2019-12-28

MORE AT Google

Excellent,told they would make special duck dish not on menu most will not do that.will let you know how it turned out.

site_logo

Thomas Banks . 2019-12-26

MORE AT Google

Food was tasty, been a while since I have visited, food and service are still good.

site_logo

Scott Langlois . 2019-12-09

MORE AT Google

We came here tonight for the first time and ordered Tom Yum soup, peanut chicken, pad Thai, and pineapple fried rice. All of the food was delicious, spiced as requested, and authentic (I’ve been to Thailand a few times). Listen to your knowledgeable server who will guide you appropriately as to your food’s “heat index.” You can always ask for the spice tray, if you require additional “heat.” The atmosphere is nice and the staff are very friendly, attentive and accommodating. I would recommend this restaurant to my Thai friends. How have they been here a year already and we just found them? You won’t be disappointed.

site_logo

NHGlobeTrotter . 2019-11-25

MORE AT TripAdvisor

Great menu, great food, great prices, great service, great ambiance! Have I made myself clear? I live about 40 minutes away and I would and will gladly travel to eat here.

site_logo

capster458 . 2019-11-22

MORE AT TripAdvisor

Great fresh food, great prices, great service

site_logo

samantha Sutherland . 2019-10-27

MORE AT Google

First time trying thai food.. the waitress, owner , AND cook were all very helpful with suggestions, and descriptions. And then the cook even came out of the back to come and check on me and make sure it was all as described and to my liking(as far as the spicy end of things)..great food, great employees and a nice clean atmosphere

site_logo

Todd Stacy . 2019-10-16

MORE AT Google

This is one of my favorite Thai resturants in the greater seacoast area. A small friendly spot that is always excellent quality. I haven't had anything on the menu that wasn't delicious.

site_logo

Aavery Mundt . 2019-10-03

MORE AT Google

We like Thai food and have tried most of the restaurants in our area and other places we visit. We have a few we will not go to again. I had been to this restaurant under the previous owners. It was just OK. We decided to try it because it had new owners. We were very pleased. Appetizers were excellent ( crab Rangoon and pork dumplings) The duck entree I had was delicious with fresh vegetables and crusty duck. My husband had a fried rice entree which he enjoyed. Staff was very attentive and helpful. We will definitely return.

site_logo

jerileez . 2019-09-22

MORE AT TripAdvisor

New ownership since Sept 2018, stopped in a few months ago thinking this was the former restaurant for this space. Have been back many times since. It's the best Thai I've had with a very friendly and attentive owner.

site_logo

RonBnh . 2019-08-10

MORE AT TripAdvisor

Quiet atmosphere. Good food! Great service! For my appetizer I had spring rolls. For dinner, I had Thai lo mein. For dessert, fried ice-cream. Good street view. WiFi available. Wontons are good, they have a sweet taste. Update; May,2019: I had the garlic salmon. Very good! Update; August, 2019; I had the Pad Glass Noodles stir fry. Very good 👍!

site_logo

Stephen Priest . 2019-08-04

MORE AT Google

Came to this place because the other thai place up the street was closed. I love the other thai place but I must say this place was great too. Been here a couple times already and I've always been greatly satisfied. Thai Taste has a larger menu and a quieter atmosphere. Overall great place, cant go wrong.

site_logo

Shawna Lei . 2019-07-30

MORE AT Google

Great environment with even better food. Alex is great and always brings a good vibe to the restaurant. If you are in the area I highly recommend Thai Taste.

site_logo

James Flynn . 2019-07-24

MORE AT Google

Great Food ~ Excellent Service ~ Cozy Atmosphere ~ Love The Curry Rice & Pad Thai ~ We Will Be Back Soon ~ Thank You

site_logo

Maine Pottery . 2019-07-24

MORE AT Google

Great Thai restaurant. Alex is great. Tell him what you want and he will make it. The Thai Chicken medium hot is a favorite.

site_logo

Robert Dusinberrre . 2019-07-20

MORE AT Google

Best Thai restaurant in Dover. I love the menu and online ordering.

site_logo

Geoff Blosser . 2019-07-19

MORE AT Google

The pad Thai was good and they have a varied menu. Lunch time specials. No kids menu however.

site_logo

Steve Esser . 2019-07-17

MORE AT Google

Great prices. The tom yum was delicious! The curry mango was also great!

site_logo

Adam Silva . 2019-07-11

MORE AT Google

Food came out fast and was very flavorful. I love spicy food, and the Spicy Drunken Noodle was perfect. Extra spicy would have definitely made me cry.

site_logo

Brady Inman . 2019-06-15

MORE AT Google

i really like this place! the staff is very kind

site_logo

Wyatt Miller . 2019-06-13

MORE AT Google

Great Thai food menu. A bit expensive but worth the trip.

site_logo

Mark Sargent . 2019-06-06

MORE AT Google

Just got back from Thailand and I will say the food is comparable. Excellent food, great service will go back!

site_logo

Janet Richards . 2019-06-03

MORE AT Google

Really good food, nice atmosphere and great service!

site_logo

Alexandre De Paula . 2019-04-25

MORE AT Google